FastPLMs is an open-source initiative dedicated to making protein language models (pLMs) efficient and easy to use. By replacing native, often suboptimal attention implementations with Flash Attention or Flex Attention, we provide high-performance alternatives that are fully compatible with the HuggingFace transformers ecosystem and can easily be loaded with no extra code with AutoModel.
- Introduction
- Documentation
- Supported Models
- Attention Backends
- Embedding & Pooling
- Experimental Test-Time Training
- Concrete Examples
- Testing & Benchmarking
- Installation & Docker
Detailed documentation is available in the docs/ folder:
- Architecture Overview - How FastPLMs wraps official models, the attention backend system, Docker layout
- Per-Model Guides - Loading, configuration, and special handling for each model family
- Attention Backends - SDPA, Flash, Flex, Auto: how they work, when to use each, numerical properties
- Embedding & Pooling API - Pooler strategies,
embed_dataset()parameters, SQLite/pth storage - Binder Design Example - FastPLMs-only ESMFold2 plus ESM++ binder optimization, CLI, metrics, and EGFR result
- Fine-Tuning Guide - LoRA, Trainer patterns, dataset classes, metrics
- Testing & Benchmarking - Docker commands, pytest markers, compliance architecture, throughput benchmarks
- Contributing - Code style, adding new models, required tests
Protein Language Models are transformer-based architectures trained on massive datasets of protein sequences (such as UniProt). These models learn the "grammar" of proteins, capturing evolutionary information, structural constraints, and functional motifs. They are used for:
- Representation Learning: Generating high-dimensional embeddings for downstream tasks (e.g., stability, function prediction).
- Protein Generation: Designing novel sequences with specific properties.
- Structure Prediction: Mapping sequences to their 3D folds (e.g., Boltz2).
FastPLMs provides optimized versions of these models. Our focus is on:
- Speed: Drastically faster inference through optimized attention kernels.
- Memory Efficiency: Lower VRAM usage, enabling larger batch sizes or longer sequences.
- Seamless Integration: Use
AutoModel.from_pretrained(..., trust_remote_code=True)to load our optimized weights directly from HuggingFace.
We maintain a comprehensive HuggingFace Collection of optimized models. Below is a summary of the supported families and their origins.
| Model Family | Organization | Official Implementation | FastPLMs Optimization | Checkpoints |
|---|---|---|---|---|
| E1 | Profluent Bio | Profluent-Bio/E1 | Flex Attention, Block-Causal | 150M, 300M, 600M |
| ESM2 | Meta AI | facebookresearch/esm | Flash (SDPA) / Flex Attention | 8M, 35M, 150M, 650M, 3B |
| ESM++ | Biohub | Biohub/esm | Optimized SDPA / Flex | Small (300M), Large (600M), 6B |
| ESM3 | Biohub | Biohub/esm | HF AutoModel wrapper | Open Small |
| ESMFold2 | Biohub | Biohub/esm | Self-contained HF AutoModel wrapper with FastPLMs ESM++ LM backbone, opt-in experimental TTT | Full, Fast, Experimental, Cutoff2025 |
| DPLM | ByteDance | bytedance/dplm | Diffusion Optimized Attention | 150M, 650M, 3B |
| DPLM2 | ByteDance | bytedance/dplm | Multimodal Diffusion | 150M, 650M, 3B |
| ANKH | Elnaggar Lab | ElnaggarLab/ankh | T5 RPE via Flex score_mod | Base, Large, ANKH2-L, ANKH3-L, ANKH3-XL |
| ESMFold | Meta AI | facebookresearch/esm | Fast ESM2 backbone, opt-in experimental ProteinTTT | Standard |
| Boltz2 | MIT / Various | jwohlwend/boltz | Optimized Structure Prediction | Standard |
FastPLMs includes experimental ProteinTTT-style test-time training utilities for
sequence PLMs and the PLM backbones used by ESMFold and ESMFold2. TTT is
disabled by default. Normal from_pretrained, forward, embed_dataset,
fold_protein, and state_dict() behavior is unchanged unless you explicitly
call ttt(), fold_protein(..., ttt=True), or fold_protein_ttt().
TTT briefly adapts a model to one input protein using masked language modeling and local LoRA adapters. It can improve predictions for difficult or low-confidence proteins, especially structure predictions with weak baseline pLDDT, but it is not guaranteed to help. It adds GPU memory use and runtime, can degrade already confident predictions, and should be treated as an experimental test-time compute option.
Supported opt-in paths:
| Model family | TTT API | Notes |
|---|---|---|
| ESM2, ESM++, ESM3, E1, DPLM, DPLM2, ANKH | model.ttt(seq=...) |
MLM LoRA adaptation of the PLM backbone only |
| FastESMFold | model.fold_protein(sequence, ttt=True) or model.fold_protein_ttt(sequence) |
Returns the best pLDDT fold across baseline and TTT steps |
| ESMFold2 | model.fold_protein(sequence, ttt=True, ttt_config=...) or model.fold_protein_ttt(sequence) |
Protein-only v1 path, trains LoRA only on the ESM++ _esmc backbone |
| Boltz2 | Not supported | Boltz2 remains inference-only in FastPLMs |
Sequence PLM example:
from transformers import AutoModelForMaskedLM
model = AutoModelForMaskedLM.from_pretrained(
"Synthyra/ESM2-8M",
trust_remote_code=True,
).cuda().eval()
# No adapters are injected until this call.
metrics = model.ttt(
seq="MSTNPKPQRKTKRNT",
ttt_config={"steps": 3, "ags": 1, "batch_size": 1},
)
model.ttt_reset()ESMFold2 example:
from transformers import AutoModel
model = AutoModel.from_pretrained(
"Synthyra/ESMFold2-Fast",
trust_remote_code=True,
load_esmc=True,
esmc_attn_backend="flex",
).cuda().eval()
result = model.fold_protein(
"MSTNPKPQRKTKRNT",
num_loops=1,
num_sampling_steps=10,
ttt=True,
ttt_config={"steps": 1, "ags": 1, "batch_size": 1},
)
print(result.ttt_metrics)ESMFold2 loads Synthyra/ESMplusplus_6B as its LM backbone by default.
Legacy biohub/ESMC-* IDs in older configs are accepted as migration aliases
and normalized to the matching Synthyra ESM++ checkpoint.
For FP8 LM inference, pass esmc_precision="fp8" and install
transformer_engine.pytorch in a CUDA environment with FP8-capable hardware.
FP8 is inference-only, so TTT remains a bf16/fp32 path.
If you use the TTT functionality, cite ProteinTTT in addition to FastPLMs and the underlying model papers. The ProteinTTT citation is listed in Citations.
Biohub ESM++ and ESM3 model cards include license: mit metadata and upload a LICENSE file copied from the Biohub ESM MIT license. The upstream license is linked from each model card and from the source repository at https://github.com/Biohub/esm/blob/main/LICENSE.md.
All FastPLMs models share a common set of attention backends, controlled via config.attn_backend. The default is "sdpa", which is safe on all hardware and numerically equivalent to standard attention.
| Backend | Key | Speed | Numerical Equivalence | Availability |
|---|---|---|---|---|
| PyTorch SDPA | "sdpa" |
Fast | Exact | Any PyTorch ≥ 2.0 |
| Flash Attention | "kernels_flash" |
Fastest | Approximate | Requires pip install kernels (pre-built) |
| Flex Attention | "flex" |
Very fast | ~Exact | Requires PyTorch ≥ 2.11 (FA4 backend on Hopper/Blackwell) |
| Auto | "auto" |
— | — | Always (selects best available) |
PyTorch's scaled_dot_product_attention dispatches to a fused CUDA kernel (cuDNN or efficient attention) that is faster and more memory-efficient than naive attention, while being mathematically identical to it. This is the recommended default for reproducibility and general use. It is also the only backend where output_attentions=True is handled natively; with other backends, attentions are computed via a separate naive matrix multiplication when requested.
Flash Attention 2 and 3 are typically the fastest options on Ampere (A100) and Hopper (H100) GPUs, often 2–4× faster than SDPA at long sequence lengths. Flash Attention achieves this by tiling the computation and applying an online softmax, which means the results are not bitwise identical to SDPA or naive attention. Differences are on the order of floating-point rounding and are often inconsequential for standard inference — but they are not guaranteed to be so. They can compound across layers, interact with low-precision dtypes (fp16/bf16), or affect sensitive downstream tasks. Flash Attention is standard practice in large model training and the trade-off is well understood, but it should not be treated as a drop-in numerical equivalent of SDPA. If exact reproducibility or numerical sensitivity is a concern, use "sdpa" instead.
No compilation required. FastPLMs uses the HuggingFace kernels package to load pre-built Flash Attention 2/3 binaries at runtime — no C++ compiler, no CUDA toolkit version pinning, no waiting:
pip install kernels
Building flash-attn from source is notoriously painful. The Ninja build system parallelizes aggressively across all available CPU cores, and each NVCC/CICC compiler process it spawns can consume 5–8 GB of RAM on its own. On a 64-core machine this can push peak RAM usage to ~300 GB, and even on a throttled single-threaded build (MAX_JOBS=1 NVCC_THREADS=1) the compile still takes many hours while grinding through paging. Pre-built community wheels cover 384+ version/GPU/CUDA/platform combinations and still routinely fall short of matching a user's exact environment. This is the point where most people give up and go without Flash Attention entirely. The kernels package sidesteps all of this by fetching a pre-compiled binary matched to your GPU architecture (SM80 for Ampere, SM90 for Hopper). If no compatible binary exists for your hardware, it gracefully falls back to flex or sdpa rather than erroring.
PyTorch's flex_attention (PyTorch >= 2.11 in FastPLMs Docker images) generates a fused Triton kernel customized to the mask pattern at hand. It is numerically very close to SDPA, typically within floating-point rounding of naive computation. The primary advantage is that it can apply a block mask that skips padding tokens entirely, providing a meaningful speedup on batches with variable-length sequences (no compute wasted on padding). E1 uses a block-causal variant of this mask.
The first forward pass triggers JIT compilation via Triton, which can take 30–120 seconds. All subsequent calls are fast. Combining with torch.compile yields the best sustained throughput.
Automatically selects the best available backend in order of preference: kernels_flash → flex → sdpa. Useful when you want maximum speed without configuring the environment manually, and you accept that the resolved backend may differ across machines.
At load time (every family):
from transformers import AutoConfig, AutoModel
config = AutoConfig.from_pretrained("Synthyra/ESM2-150M", trust_remote_code=True)
config.attn_backend = "flex" # "sdpa", "kernels_flash", "flex", or "auto"
model = AutoModel.from_pretrained("Synthyra/ESM2-150M", config=config, trust_remote_code=True)After load time (every family):
Every family's PreTrainedModel subclass exposes a mutable attn_backend property whose setter propagates the change to every attention submodule in-place, so you can swap backends on a loaded model without reloading the weights:
model = AutoModel.from_pretrained("Synthyra/ESM2-150M", trust_remote_code=True)
model.attn_backend = "flex" # every attention layer now uses flex
model.attn_backend = "kernels_flash" # flip again, no reloadThis is handy for benchmarking backends on the same weights or for falling back at runtime if a backend is unavailable. The setter asserts if the requested backend isn't installed on the current GPU (e.g. kernels_flash without the kernels package).
All backends support output_attentions=True. For the optimized backends (SDPA, Flash Attention, Flex), attention weights are computed via a separate naive matrix multiplication and appended to the output — so enabling this negates the memory savings of those backends. Use it only for inspection or contact prediction, not during high-throughput inference.
The EmbeddingMixin (shared across all models) provides a standardized way to extract representations from proteins.
The Pooler class aggregates sequence-level residue representations into a single fixed-size vector. Supported strategies include:
mean: Mask-aware average of all residues.cls: The first token's representation (Standard for classification).max: Element-wise maximum across the sequence.var/std: Variance or Standard Deviation of representations.norm: L2 normalization.median: Element-wise median.parti: Experimental PageRank-based attention pooling.
Ideal for embedding millions of sequences where you need to stream data or avoid OOM on RAM.
import torch
from transformers import AutoModel
model = AutoModel.from_pretrained("Synthyra/ESM2-150M", trust_remote_code=True).cuda()
sequences = ["MALWMRLLPLLALLALWGPDPAAA", "MKTIIALSYIFCLVFA", ...]
# Embed and store in SQLite
model.embed_dataset(
sequences=sequences,
batch_size=64,
pooling_types=['mean', 'cls'], # Concatenates both
sql=True,
sql_db_path='large_protein_db.db',
embed_dtype=torch.float32
)Pass a FASTA file path directly — no manual parsing required. Multi-line sequences are handled automatically. You can combine fasta_path with an explicit sequences list and the two sources are merged before embedding.
# Embed all sequences in a FASTA file and save to SQLite
model.embed_dataset(
fasta_path='my_proteins.fasta',
batch_size=64,
pooling_types=['mean'],
sql=True,
sql_db_path='my_proteins.db',
)
# Mix a FASTA file with an explicit list
model.embed_dataset(
sequences=["MKTIIALSYIFCLVFA"],
fasta_path='additional_proteins.fasta',
batch_size=32,
save=True,
save_path='combined_embeddings.pth',
)Perfect for medium-sized datasets that fit in memory.
# Embed and return as a dictionary
embeddings = model.embed_dataset(
sequences=sequences,
batch_size=128,
pooling_types=['mean'],
save=True,
save_path='my_embeddings.pth'
)
# Access embedding
seq_vector = embeddings["MALWMRLLPLLALLALWGPDPAAA"] # torch.TensorConcatenate multiple mathematical representations for richer downstream features.
# Use a variety of pooling types
embeddings = model.embed_dataset(
sequences=sequences,
pooling_types=['mean', 'max', 'std', 'var'], # All 4 concatenated
batch_size=32,
full_embeddings=False
)
# Resulting vector size: 4 * hidden_size
print(embeddings[sequences[0]].shape)FastPLMs includes a binder design workflow that mirrors the Biohub ESMFold2 tutorial while using only FastPLMs model repos. ESMFold2 experimental checkpoints provide differentiable folding losses and final critics, while ESM++ provides the masked-LM pseudoperplexity regularizer.
Run the verified EGFR 128 amino acid de novo minibinder example on a CUDA workstation with the ESMFold2 Docker image:
cd /home/ubuntu/FastPLMs
sudo -n docker run --gpus all --rm \
-v /home/ubuntu/FastPLMs:/app \
-v /home/ubuntu/FastPLMs:/workspace \
-v /home/ubuntu/.cache/huggingface:/workspace/.cache/huggingface \
-w /workspace fastplms-esmfold2 \
python /app/cookbook/tutorials/binder_design_fastplms.py \
--backend local \
--target-name egfr \
--binder-sequence '################################################################################################################################' \
--not-antibody \
--steps 150 \
--batch-size 1 \
--seed 103 \
--output-dir /workspace/campaign_egfr_len128_b1_s150_seed103_consensus_cliThe run writes trajectory.jsonl, best_sequences.fasta, results.parquet,
selection.parquet, and per-critic PDB/CIF/logit files. The verified result had
hero mean iPTM 0.913870, hero min iPTM 0.904600, and all four hero
ESMFold2 critics above 0.9.
Binder sequence:
SAVKHLLEIVKYLEEAIEKALEVDPVFLVPPAAEELLIAAKVIKELAKENPELIEVYELLMKAVKGLKKLVRSNDKEILREVIRLLRKAAKVIREILKNNPDLDPELRKALEELAKVLEEIAEVLEQQ
See docs/binder_design.md for the full strategy, official selection rule, Modal backend, per-critic metrics, and caveats.
FastPLMs includes a pytest-based test suite under testing/ covering correctness, compliance, and performance. All GPU tests run inside Docker. See docs/testing.md for the full guide.
| Test | What it checks | Marker |
|---|---|---|
| AutoModel loading | Every model loads via the relevant Transformers auto class with trust_remote_code=True and produces valid outputs |
gpu |
| Backend consistency | SDPA, Flex, and Flash backends produce equivalent predictions (>= 95% agreement) | gpu |
| Weight compliance | FastPLM weights are bit-exact with the original implementations (ESM2, ESMC, ESM3, E1, DPLM) | slow, gpu |
| Forward compliance | Forward pass logits/predictions match the originals within tolerance | slow, gpu |
| Rigorous parity | Per-layer fp32 + bf16 hidden-state and last_hidden_state parity, padding-isolation, tokenizer parity, embed_dataset pipeline parity. Run per family in its own Docker image. | gpu |
| NaN stability | Batched inference with padding produces no NaN in real-token embeddings | gpu |
| Batch-single match | Batch and single-item embedding produce identical results | gpu |
| Full model suite | All of the above across every checkpoint (8M through 3B) | gpu, large |
| Throughput benchmark | Tokens/sec across models, backends, batch sizes, and sequence lengths | slow, gpu |
| Structure models | Boltz2, ESMFold, and ESMFold2 loading + forward/parity checks | structure, slow, gpu |
FastPLMs uses a per-family Docker setup. A single shared base image (fastplms-base) holds torch + transformers + the FastPLMs source, and one image per model family (fastplms-esm2, fastplms-esm_plusplus, fastplms-esm3, fastplms-esmfold2, fastplms-e1, fastplms-dplm, fastplms-dplm2, fastplms-ankh) layers on top with that family's native reference package. This isolates conflicting dependencies (e.g. Biohub esm vs fair-esm, DPLM's torchtext pin) and keeps each image small.
# Initialize submodules (required before building Docker)
git submodule update --init --recursive
# Build base + every family image
./build_images.sh
# Build a single family
./build_images.sh esm2
./build_images.sh esm_plusplus
./build_images.sh esm3
./build_images.sh esmfold2Run the parity / compliance tests for one family inside its image:
# ESM2
docker run --rm --gpus all --ipc=host -v $(pwd):/workspace fastplms-esm2 \
python -m pytest /workspace/testing/test_parity.py -k esm2 -v
# ESM++ (model_key is "esmc")
docker run --rm --gpus all --ipc=host -v $(pwd):/workspace fastplms-esm_plusplus \
python -m pytest /workspace/testing/test_parity.py -k esmc -v
# ESM3, requires accepted access to biohub/esm3-sm-open-v1 for official parity
docker run --rm --gpus all --ipc=host -v $(pwd):/workspace fastplms-esm3 \
python -m pytest /workspace/testing/test_parity.py -k esm3 -v
# ESMFold2 / ESMFold2-Fast
docker run --rm --gpus all --ipc=host -v $(pwd):/workspace fastplms-esmfold2 \
python -m pytest /workspace/testing/test_esmfold2.py -v -s
# E1, DPLM, DPLM2, ANKH
for fam in e1 dplm dplm2 ankh; do
docker run --rm --gpus all --ipc=host -v $(pwd):/workspace fastplms-$fam \
python -m pytest /workspace/testing/test_parity.py -k $fam -v
doneThe legacy monolithic Dockerfile (image tag fastplms) is still supported for the broader test suites that don't need native package isolation:
docker build -t fastplms .
# Fast tests (small models, no compliance, no structure)
docker run --gpus all --ipc=host fastplms python -m pytest /app/testing/ -m "gpu and not slow and not large and not structure" -v
# All sequence model tests except 3B
docker run --gpus all --ipc=host fastplms python -m pytest /app/testing/ -m "not large and not structure" -v
# Full suite including 3B models (requires 40+ GB VRAM)
docker run --gpus all --ipc=host fastplms python -m pytest /app/testing/ -m "not structure" -v
# Structure models only (Boltz2, ESMFold, ESMFold2)
docker run --gpus all --ipc=host fastplms python -m pytest /app/testing/ -m "structure" -vOn Windows, replace $(pwd) with ${PWD}. Always pass --ipc=host with PyTorch.
The parity and compliance tests compare FastPLM outputs against the original model implementations. Each per-family Docker image installs only the deps it needs; outside Docker you can install them piecewise:
| Dependency | Used by | Install |
|---|---|---|
cloudpathlib, zstd, biotite (+ official/esm submodule on sys.path) |
ESM++ / ESMC, ESM3 official parity | provided by Dockerfile.esm_plusplus and Dockerfile.esm3; the Biohub esm package itself is not pip-installed because it depends on a Biohub transformers fork. |
Biohub transformers fork, rdkit, biotite, msgpack-numpy, pydssp, pygtrie, py3dmol |
ESMFold2 parity and structure export; runtime LM loading uses FastPLMs ESM++ | provided by Dockerfile.esmfold2 |
E1 |
E1 | pip install -e official/e1 (or use Dockerfile.e1) |
transformers (EsmForMaskedLM, T5EncoderModel) |
ESM2, DPLM, ANKH | already in requirements.txt |
If a native dep is missing in your environment, the corresponding parity tests are skipped rather than failing.
Throughput can be measured via the pytest test (saves structured JSON/CSV/PNG results) or the standalone script (more configurable).
# Pytest (benchmarks ESM2-8M, ESMplusplus_small, DPLM-150M, DPLM2-150M across all backends)
docker run --gpus all -v $(pwd):/workspace fastplms python -m pytest /app/testing/test_throughput.py -v -s
# Output: throughput_results.json, throughput_results.csv, throughput_comparison.png
# Standalone (fully configurable)
docker run --gpus all -v $(pwd):/workspace fastplms \
python -m testing.throughput \
--model_paths Synthyra/ESM2-8M Synthyra/ESMplusplus_small \
--backends sdpa flex kernels_flash \
--batch_sizes 2 4 8 \
--sequence_lengths 64 128 256 512 1024 2048 \
--output_path /workspace/throughput_comparison.pngFastPLMs is developed and tested with Python 3.12 and CUDA 12.8. For local GPU installs, install the cu128 PyTorch wheels first, then the pinned direct dependencies:
git clone --recurse-submodules https://github.com/Synthyra/FastPLMs.git
cd FastPLMs
python -m pip install --upgrade pip==26.1.1 setuptools==70.2.0
python -m pip install torch==2.11.0 torchvision==0.26.0 --index-url https://download.pytorch.org/whl/cu128
python -m pip install -r requirements.txtIf you already cloned without --recurse-submodules, initialize submodules separately:
git submodule update --init --recursiveThere are two Docker layouts; pick whichever matches your task.
Per-family layout (recommended for parity / compliance work). A shared base image plus one image per model family, each with that family's native reference package isolated from the others. Build all of them once with the helper script:
git submodule update --init --recursive
./build_images.sh # base + every family
./build_images.sh esm2 esm_plusplus # subsetThis produces fastplms-base and fastplms-{esm2,esm_plusplus,esm3,e1,dplm,dplm2,ankh}. Run a family's tests in its image:
docker run --rm --gpus all --ipc=host -v $(pwd):/workspace fastplms-esm2 \
python -m pytest /workspace/testing/test_parity.py -k esm2 -v
docker run --rm --gpus all --ipc=host -v $(pwd):/workspace -it fastplms-esm2 bashMonolithic layout (legacy, single image). The original Dockerfile bundles every dependency that can coexist in one image. Convenient for the broad test suites and throughput benchmarks; not suitable when two families' native deps conflict (notably Biohub esm vs fair-esm).
git submodule update --init --recursive
docker build -t fastplms .
docker run --gpus all --ipc=host fastplms python -m pytest /app/testing/ -v
docker run --gpus all --ipc=host -v $(pwd):/workspace -it fastplms bashOn Windows, replace $(pwd) with ${PWD}. Always pass --ipc=host with PyTorch.
Found a bug or have a feature request? Please open a GitHub Issue. We are actively looking for contributions to optimize more pLM architectures!
If you use FastPLMs, please cite the following along with the relevant model paper(s).
@misc{FastPLMs,
author={Hallee, Logan and Bichara, David and Gleghorn, Jason P.},
title={FastPLMs: Fast, efficient, protein language model inference from Huggingface AutoModel.},
year={2024},
url={https://huggingface.co/Synthyra/ESMplusplus_small},
DOI={10.57967/hf/3726},
publisher={Hugging Face}
}@article{dong2024flexattention,
title={Flex Attention: A Programming Model for Generating Optimized Attention Kernels},
author={Dong, Juechu and Feng, Boyuan and Guessous, Driss and Liang, Yanbo and He, Horace},
journal={arXiv preprint arXiv:2412.05496},
year={2024}
}@inproceedings{paszke2019pytorch,
title={PyTorch: An Imperative Style, High-Performance Deep Learning Library},
author={Paszke, Adam and Gross, Sam and Massa, Francisco and Lerer, Adam and Bradbury, James and Chanan, Gregory and Killeen, Trevor and Lin, Zeming and Gimelshein, Natalia and Antiga, Luca and Desmaison, Alban and K{\"o}pf, Andreas and Yang, Edward and DeVito, Zach and Raison, Martin and Tejani, Alykhan and Chilamkurthy, Sasank and Steiner, Benoit and Fang, Lu and Bai, Junjie and Chintala, Soumith},
booktitle={Advances in Neural Information Processing Systems 32},
year={2019}
}@article{lin2023esm2,
title={Evolutionary-scale prediction of atomic-level protein structure with a language model},
author={Lin, Zeming and Akin, Halil and Rao, Roshan and Hie, Brian and Zhu, Zhongkai and Lu, Wenting and Smestad, Nikita and Verkuil, Robert and Kabeli, Ori and Shmueli, Yaniv and dos Santos Costa, Allan and Fazel-Zarandi, Maryam and Sercu, Tom and Candido, Salvatore and Rives, Alexander},
journal={Science},
volume={379},
number={6637},
pages={1123--1130},
year={2023},
DOI={10.1126/science.ade2574}
}@misc{candido2026language,
title = {Language Modeling Materializes a World Model of Protein Biology},
author = {Candido, Salvatore and Hayes, Thomas and Derry, Alexander and Rao, Roshan
and Lin, Zeming and Verkuil, Robert and Wu, Bryan and Lee, Jin Sub
and Bruguera, Elise S. and Keval, Jehan A. and Kopylov, Mykhailo
and Pak, John E. and Wu, Wesley and Thomas, Neil and Mataraso, Samson
and Hsu, Alvin and Trotman-Grant, Ashton C. and Fatras, Kilian
and dos Santos Costa, Allan and Badkundri, Rohil and Ak{\i}n, Halil
and Oktay, Deniz and Deaton, Jonathan and Montabana, Elizabeth
and Sitwala, Hrishita and Yu, Yue and Wiggert, Marius
and Carlin, Dylan Alexander and Goering, Anthony W. and Blazejewski, Tomasz
and Sandora, McCullen and Hla, Michael and Jia, Tina Z.
and Kloker, Leon H. and Sofroniew, Nicholas J. and Uehara, Masatoshi
and Pannu, Jassi and Bachas, Sharrol and Liu, Daniel S.
and Sercu, Tom and Rives, Alexander},
year = {2026},
url = {https://biohub.ai/papers/esm_protein.pdf},
note = {Preprint}
}@article{jain2025e1,
title={E1: Retrieval-Augmented Protein Encoder Models},
author={Jain, Sarthak and Beazer, Joel and Ruffolo, Jeffrey A and Bhatnagar, Aadyot and Madani, Ali},
journal={bioRxiv},
DOI={10.1101/2025.11.12.688125},
year={2025}
}@article{wang2024dplm,
title={Diffusion Language Models Are Versatile Protein Learners},
author={Wang, Xinyou and Ye, Zaixiang and Huang, Fei and Cao, Dongyan and Liang, Shujian and Huang, Liang},
journal={Proceedings of the 41st International Conference on Machine Learning},
year={2024}
}@article{wang2024dplm2,
title={DPLM-2: A Multimodal Diffusion Protein Language Model},
author={Wang, Xinyou and Ye, Zaixiang and Huang, Fei and Cao, Dongyan and Liang, Shujian and Huang, Liang},
journal={arXiv preprint arXiv:2410.13782},
year={2024}
}@article{elnaggar2023ankh,
title={Ankh: Optimized Protein Language Model Unlocks General-Purpose Modelling},
author={Elnaggar, Ahmed and Essam, Hazem and Salah-Eldin, Wafaa and Moustafa, Walid and Elkerdawy, Mohamed and Rochereau, Charlotte and Rost, Burkhard},
journal={arXiv preprint arXiv:2301.06568},
year={2023}
}@article{alsamkary2025ankh3,
title={Ankh3: Multi-Task Pretraining with Sequence Denoising and Completion Enhances Protein Representations},
author={Alsamkary, Hazem and Elshaffei, Mohamed and Elkerdawy, Mohamed and Elnaggar, Ahmed},
journal={arXiv preprint arXiv:2505.20052},
year={2025}
}@article{passaro2025boltz2,
title={Boltz-2: Exploring the Frontiers of Biomolecular Prediction},
author={Passaro, Saro and Corso, Gabriele and Wohlwend, Jeremy and Reveiz, Mateo and Bordes, Florian and Wicky, Basile and Dayan, Peter and Jing, Bowen},
journal={bioRxiv},
year={2025}
}@article{wohlwend2024boltz1,
title={Boltz-1: Democratizing Biomolecular Interaction Modeling},
author={Wohlwend, Jeremy and Corso, Gabriele and Passaro, Saro and Reveiz, Mateo and Leidal, Ken and Swanson, Wojtek and Kher, Gilmer and Lember, Tommi and Jaakkola, Tommi},
journal={bioRxiv},
year={2024}
}@misc{bushuiev2026proteinneed,
title={One protein is all you need},
author={Anton Bushuiev and Roman Bushuiev and Olga Pimenova and Nikola Zadorozhny and Raman Samusevich and Elisabet Manaskova and Rachel Seongeun Kim and Hannes St\"ark and Jiri Sedlar and Martin Steinegger and Tom\'a\v{s} Pluskal and Josef Sivic},
year={2026},
eprint={2411.02109},
archivePrefix={arXiv},
primaryClass={cs.LG},
url={https://arxiv.org/abs/2411.02109}
}