Skip to content

Latest commit

 

History

History
538 lines (395 loc) · 20.3 KB

File metadata and controls

538 lines (395 loc) · 20.3 KB

Per-Model Guides

This document covers each model family supported by FastPLMs: loading, configuration, special handling, and available checkpoints.

Most sequence models (ESM2, ESM++, E1, DPLM, DPLM2, ANKH) share the same embedding pipeline via EmbeddingMixin. ESM3 exposes its own compatible embed_dataset() method for sequence embeddings. They support most attention backends, with these exceptions: ANKH supports only sdpa and flex, and ESM3 supports sdpa and flex. Structure prediction models (Boltz2, ESMFold, ESMFold2, and ESMFold2-Fast) have their own APIs.

Experimental test-time training (TTT) is available for ESM2, ESM++, ESM3, E1, DPLM, DPLM2, ANKH, FastESMFold, and ESMFold2. It is disabled by default and is only activated by explicit calls such as model.ttt(...), fold_protein(..., ttt=True), or fold_protein_ttt(...). TTT trains small LoRA adapters with a masked language modeling objective on the test protein. It can improve difficult or low-confidence cases, but it adds test-time compute and can degrade already strong predictions. Treat it as experimental.


ESM2

Organization: Meta AI Architecture: Transformer encoder with rotary position embeddings (RoPE) Checkpoints: 8M, 35M, 150M, 650M, 3B

Loading

from transformers import AutoModelForMaskedLM, AutoConfig

# Default (SDPA backend)
model = AutoModelForMaskedLM.from_pretrained("Synthyra/ESM2-150M", trust_remote_code=True)

# With a specific backend
config = AutoConfig.from_pretrained("Synthyra/ESM2-150M", trust_remote_code=True)
config.attn_backend = "flex"
model = AutoModelForMaskedLM.from_pretrained("Synthyra/ESM2-150M", config=config, trust_remote_code=True)

Key Details

  • Uses the standard ESM tokenizer (EsmTokenizer from transformers)
  • Tokenizer accessible via model.tokenizer
  • Backend can be set on the config before from_pretrained OR via the mutable model.attn_backend property after load (same mechanism as every other family).
  • Pre-LayerNorm architecture with a final emb_layer_norm_after
  • Supports output_attentions=True and output_hidden_states=True
  • Experimental TTT is opt-in via model.ttt(seq=...); no LoRA adapters are injected during normal inference.

Available Checkpoints

Checkpoint HuggingFace ID Official Reference
ESM2-8M Synthyra/ESM2-8M facebook/esm2_t6_8M_UR50D
ESM2-35M Synthyra/ESM2-35M facebook/esm2_t12_35M_UR50D
ESM2-150M Synthyra/ESM2-150M facebook/esm2_t30_150M_UR50D
ESM2-650M Synthyra/ESM2-650M facebook/esm2_t33_650M_UR50D
ESM2-3B Synthyra/ESM2-3B facebook/esm2_t36_3B_UR50D

ESM++ (ESMC)

Organization: Biohub Architecture: Transformer encoder with configurable rotary embeddings (scaling, interleaving) Checkpoints: Small (300M), Large (600M), 6B

Loading

from transformers import AutoModelForMaskedLM

model = AutoModelForMaskedLM.from_pretrained("Synthyra/ESMplusplus_small", trust_remote_code=True)

Key Details

  • Uses the ESM tokenizer (same as ESM2)
  • Requires sequence_id parameter for batched inference: sequence_id = attention_mask.to(dtype=torch.bool)
  • Uses einops for tensor reshaping operations
  • Rotary embeddings support interleaved mode and scale_base/scaling_factor for dynamic scaling
  • Backend can be set on the config before from_pretrained OR via the mutable model.attn_backend property after load.
  • Experimental TTT is opt-in via model.ttt(seq=...); it adapts the PLM backbone only.

Batched Forward Pass

tokenizer = model.tokenizer
tokenized = tokenizer(sequences, return_tensors="pt", padding=True)
tokenized = {k: v.to(device) for k, v in tokenized.items()}
tokenized["sequence_id"] = tokenized["attention_mask"].to(dtype=torch.bool)

with torch.inference_mode():
    output = model(**tokenized)

Available Checkpoints

Checkpoint HuggingFace ID Official Reference
ESM++ Small (300M) Synthyra/ESMplusplus_small biohub/ESMC-300M
ESM++ Large (600M) Synthyra/ESMplusplus_large biohub/ESMC-600M
ESM++ 6B Synthyra/ESMplusplus_6B biohub/ESMC-6B

Binder Design Role

The FastPLMs binder design tutorial uses ESM++ as the masked-LM pseudoperplexity regularizer on mutable binder residues. The verified EGFR run uses Synthyra/ESMplusplus_6B by default, paired with FastPLMs ESMFold2 experimental checkpoints for differentiable folding and final criticism.

See Binder Design Example for the full local and Modal workflow, official selection metrics, and the verified EGFR 128 amino acid minibinder result.


ESM3

Organization: Biohub Architecture: Multimodal protein model over sequence, structure, and function tracks Checkpoints: Open Small

Loading

import torch
from transformers import AutoModel

model = AutoModel.from_pretrained(
    "Synthyra/ESM3_small",
    trust_remote_code=True,
    dtype=torch.bfloat16,
    device_map="cuda",
)

AutoModelForMaskedLM also resolves to the same ESM3 wrapper class, which returns sequence logits plus ESM3 track logits.

Key Details

  • Supports sequence-only inference by default via input_ids and attention_mask.
  • Additional ESM3 tracks can be passed as tensors: structure_tokens, ss8_tokens, sasa_tokens, function_tokens, residue_annotation_tokens, average_plddt, per_res_plddt, structure_coords, chain_id, and sequence_id.
  • Exposes forward_sequence() and tokenize_sequences() helpers for ergonomic sequence inference.
  • Supports embed_dataset() with pooled mean, cls, and max embeddings, plus residue-wise embeddings through full_embeddings=True.
  • Supports sdpa and flex attention backends.
  • Includes the Biohub ESM MIT license in the Hub LICENSE file and model card metadata.
  • Experimental TTT is opt-in via model.ttt(seq=...) and uses sequence_logits only.

Available Checkpoints

Checkpoint HuggingFace ID Official Reference
ESM3 Small Synthyra/ESM3_small biohub/esm3-sm-open-v1

E1

Organization: Profluent Bio Architecture: Transformer with within-sequence and global (block-causal) attention layers Checkpoints: 150M, 300M, 600M

Loading

from transformers import AutoModelForMaskedLM

model = AutoModelForMaskedLM.from_pretrained("Synthyra/Profluent-E1-150M", trust_remote_code=True)

Key Details

  • Sequence mode: E1 does not use a standard HuggingFace tokenizer. Tokenization is built into the model via E1BatchPreparer
  • Uses RMSNorm (not LayerNorm)
  • Grouped-query attention (num_key_value_heads < num_heads)
  • Two attention layer types that alternate:
    • WITHIN_SEQ: Attention within individual sequences only
    • GLOBAL: Cross-sequence block-causal attention
  • Separate RoPE configurations for within-sequence and global attention (different rope_theta)
  • KV caching via DynamicCache for efficient generation
  • Backend can be set on the config before from_pretrained OR via the mutable model.attn_backend property after load.
  • Experimental TTT is opt-in via model.ttt(seq=...); the E1 path carries input_ids, within_seq_position_ids, global_position_ids, and sequence_ids.

Tokenization (Sequence Mode)

E1's tokenization happens via model.model.prep_tokens:

batch_kwargs = model.model.prep_tokens.get_batch_kwargs(sequences, device=device)
# Returns dict with:
#   input_ids, within_seq_position_ids, global_position_ids,
#   sequence_ids, labels, context, context_len

For the embed_dataset() pipeline, pass tokenizer=None and the mixin handles E1's sequence mode automatically.

Embedding Extraction

embeddings = model.embed_dataset(
    sequences=["MKTLLILAVVAAALA", "MALWMRLLPLLALL"],
    batch_size=2,
    tokenizer=None,  # E1 uses sequence mode
    pooling_types=["mean"],
    save=False,
)

MSA Context And PPLL

FastPLMs exposes E1 MSA context utilities directly on the model object:

a3m_path = model.search_homologues(
    sequence="MALWMRLLPLLALLALWGPDPAAA",
    output_dir="msas",
    provider="colabfold",
)

scores = model.score_ppll(
    sequences=["MALWMRLLPLLALLALWGPDPAAA"],
    a3m_path=a3m_path,
    ensemble=True,
)

embeddings = model.embed_with_msa(
    sequences=["MALWMRLLPLLALLALWGPDPAAA"],
    a3m_path=a3m_path,
    pooling_types=["mean"],
)

MSA parsing and context sampling match Profluent's official E1 msa_sampling behavior. score_ppll() intentionally differs from the official E1Scorer: FastPLMs reports mean correct-token probability for each scored sequence and optionally averages across sampled contexts, rather than computing mutant deltas against a parent sequence. This is much cheaper and is the preferred scoring path here.

Available Checkpoints

Checkpoint HuggingFace ID Official Reference
E1-150M Synthyra/Profluent-E1-150M Profluent-Bio/E1-150m
E1-300M Synthyra/Profluent-E1-300M Profluent-Bio/E1-300m
E1-600M Synthyra/Profluent-E1-600M Profluent-Bio/E1-600m

Compliance Dependencies

E1 compliance tests require the official E1 package:

pip install E1 @ git+https://github.com/Profluent-AI/E1.git

This is pre-installed in the Docker image.


DPLM

Organization: ByteDance Architecture: Diffusion-optimized transformer based on ESM2 architecture Checkpoints: 150M, 650M, 3B

Loading

from transformers import AutoModelForMaskedLM

model = AutoModelForMaskedLM.from_pretrained("Synthyra/DPLM-150M", trust_remote_code=True)

Key Details

  • Uses the ESM tokenizer (same as ESM2)
  • Backend can be set on the config before from_pretrained or via the mutable model.attn_backend property after load.
  • Architecture extends EsmConfig and EsmPreTrainedModel from HuggingFace
  • Supports cross-attention and KV caching for generation
  • ModifiedEsmSelfAttention extends the official EsmSelfAttention with multi-backend support
  • Experimental TTT is opt-in via model.ttt(seq=...); normal DPLM inference and diffusion APIs are unchanged.

Post-Load Backend Switching

model = AutoModelForMaskedLM.from_pretrained("Synthyra/DPLM-150M", trust_remote_code=True)
model.attn_backend = "flex"  # Updates every attention layer in-place

Available Checkpoints

Checkpoint HuggingFace ID Official Reference
DPLM-150M Synthyra/DPLM-150M airkingbd/dplm_150m
DPLM-650M Synthyra/DPLM-650M airkingbd/dplm_650m
DPLM-3B Synthyra/DPLM-3B airkingbd/dplm_3b

DPLM2

Organization: ByteDance Architecture: Multimodal diffusion transformer handling both sequence and structure tokens Checkpoints: 150M, 650M, 3B

Loading

from transformers import AutoModelForMaskedLM

model = AutoModelForMaskedLM.from_pretrained("Synthyra/DPLM2-150M", trust_remote_code=True)

Key Details

  • Uses the ESM tokenizer
  • Multimodal input: Handles both amino acid tokens and structure tokens in packed sequences
  • Mutable model.attn_backend property (same as DPLM)
  • Special token normalization: _normalize_dplm2_input_ids() maps tokens above vocab_size back into range
  • Packed multimodal layout detection: _has_packed_multimodal_layout() checks if input_ids contain interleaved AA and structure tokens
  • The official DPLM2 has an extra contact_head not present in the FastPLM version, so weight compliance testing is skipped for this family
  • Experimental TTT is opt-in via model.ttt(seq=...); it adapts only LoRA weights on the PLM backbone.

Available Checkpoints

Checkpoint HuggingFace ID Official Reference
DPLM2-150M Synthyra/DPLM2-150M airkingbd/dplm2_150m
DPLM2-650M Synthyra/DPLM2-650M airkingbd/dplm2_650m
DPLM2-3B Synthyra/DPLM2-3B airkingbd/dplm2_3b

ANKH

Organization: Elnaggar Lab Architecture: T5-style encoder with bidirectional gated GELU FFN and learned relative position bias (bucketed) Checkpoints: Base, Large, ANKH2-Large, ANKH3-Large, ANKH3-XL

Loading

from transformers import AutoModelForMaskedLM, AutoConfig

# Default (SDPA)
model = AutoModelForMaskedLM.from_pretrained("Synthyra/ANKH_base", trust_remote_code=True)

# Flex backend (block-mask aware)
config = AutoConfig.from_pretrained("Synthyra/ANKH_base", trust_remote_code=True)
config.attn_backend = "flex"
model = AutoModelForMaskedLM.from_pretrained("Synthyra/ANKH_base", config=config, trust_remote_code=True)

Key Details

  • Uses the checkpoint-matched ANKH T5 tokenizer exposed through each Synthyra checkpoint
  • Tokenizer accessible via model.tokenizer
  • Backend can be set on the config before from_pretrained OR via the mutable model.attn_backend property after load (same mechanism as every other family).
  • Attention is unscaled (no 1/sqrt(d_kv) factor). T5 trains without scaling; the learned relative position bias absorbs the temperature.
  • Only sdpa and flex are supported. Requesting kernels_flash silently falls back to flex (or sdpa if flex is unavailable) because flash kernels can't accept additive position bias.
  • Layer 0 owns the relative-position-bias nn.Embedding; subsequent layers receive the precomputed bias through the forward call.
  • The native ANKH checkpoint is a T5 encoder-decoder; FastPLMs uses the encoder only and bolts on a separate lm_head for the ForMaskedLM variant. For weight-parity comparisons against transformers.T5EncoderModel, the FastPLMs lm_head.weight is allowlisted as an expected extra parameter.
  • ANKH3 checkpoints use 256-token tokenizers, while ANKH v1/v2 checkpoints use 144-token tokenizers. Use the checkpoint tokenizer through model.tokenizer or AutoTokenizer.from_pretrained(<checkpoint>).
  • Experimental TTT is opt-in via model.ttt(seq=...); the ANKH MaskedLM head is not pretrained for standard MLM, so results should be treated especially cautiously.

Available Checkpoints

Checkpoint HuggingFace ID Official Reference
ANKH-base Synthyra/ANKH_base ElnaggarLab/ankh-base
ANKH-large Synthyra/ANKH_large ElnaggarLab/ankh-large
ANKH2-large Synthyra/ANKH2_large ElnaggarLab/ankh2-ext2
ANKH3-large Synthyra/ANKH3_large ElnaggarLab/ankh3-large
ANKH3-XL Synthyra/ANKH3_xl ElnaggarLab/ankh3-xl

Boltz2

Organization: MIT / Various Architecture: Diffusion-based structure prediction model Checkpoints: Standard

Loading

from transformers import AutoModel

model = AutoModel.from_pretrained("Synthyra/Boltz2", trust_remote_code=True, dtype=torch.float32)

Key Details

  • Structure prediction model, not a sequence encoder. Does not inherit from EmbeddingMixin
  • Uses AutoModel (not AutoModelForMaskedLM)
  • Custom featurization pipeline via minimal_featurizer.build_boltz2_features()
  • Outputs atomic coordinates, pLDDT, pTM, ipTM confidence scores
  • Can export predictions as CIF files via model.save_as_cif(output, "pred.cif")
  • TTT is not supported for Boltz2 in FastPLMs.

Predict Structure

output = model.predict_structure(
    amino_acid_sequence="MSTNPKPQRKTKRNTNRRPQDVKFPGG",
    recycling_steps=3,
    num_sampling_steps=200,
    diffusion_samples=1,
)
print(output.sample_atom_coords.shape)  # (N_atoms, 3)
print(output.plddt.shape)               # (N_residues,)

Compliance Testing

Boltz2 compliance is tested via a standalone script (testing/run_boltz2_compliance.py) that compares coordinates, pairwise distances, and TM-scores against the official implementation.


ESMFold2

Organization: Biohub Architecture: ESMC-backed diffusion structure predictor Checkpoints: Full, Fast, Experimental, Experimental-Fast, Cutoff2025 variants

Loading

import torch
from transformers import AutoModel

model = AutoModel.from_pretrained(
    "Synthyra/ESMFold2-Fast",
    trust_remote_code=True,
    dtype=torch.float32,
).eval().cuda()

Key Details

  • Uses AutoModel, not AutoModelForMaskedLM.
  • Can fold single chains and multi-chain complexes.
  • Loads the embedded PLM through Synthyra/ESMplusplus_6B by default, using FastPLMs ESM++ with config.esmc_attn_backend = "flex".
  • Exposes fold_protein(), fold(), prepare_structure_input(), result_to_cif(), and result_to_pdb().
  • Experimental checkpoints support res_type_soft for differentiable binder sequence optimization.
  • Final scoring can report pTM, iPTM, pLDDT, structures, and distogram logits.
  • set_kernel_backend(), set_chunk_size(), and apply_torch_compile() are available on the ESMFold2 wrappers.
  • Experimental TTT is opt-in via fold_protein(..., ttt=True) or fold_protein_ttt(...); it trains LoRA adapters only on _esmc, not the folding trunk, confidence head, or diffusion head.

Available Checkpoints

Checkpoint HuggingFace ID Use
ESMFold2 Synthyra/ESMFold2 Full released structure predictor
ESMFold2-Fast Synthyra/ESMFold2-Fast Faster released structure predictor
ESMFold2-Experimental-Fast Synthyra/ESMFold2-Experimental-Fast Binder inversion and hero critic
ESMFold2-Experimental-Fast-Cutoff2025 Synthyra/ESMFold2-Experimental-Fast-Cutoff2025 Binder inversion and hero critic
ESMFold2-Experimental Synthyra/ESMFold2-Experimental Final hero critic
ESMFold2-Experimental-Cutoff2025 Synthyra/ESMFold2-Experimental-Cutoff2025 Final hero critic

Binder Design Example

The FastPLMs binder workflow lives at cookbook/tutorials/binder_design_fastplms.py and supports local CUDA or Modal execution. The optimizer follows the official ESM strategy: continuous amino acid logits, cysteine suppression, ESMFold2 distogram structure losses, ESM++ pseudoperplexity, late-trajectory iPTM selection, and final critic ranking.

python cookbook/tutorials/binder_design_fastplms.py \
  --backend local \
  --target-name egfr \
  --binder-sequence '################################################################################################################################' \
  --not-antibody \
  --steps 150 \
  --batch-size 1 \
  --seed 103 \
  --output-dir binder_design_egfr_len128_seed103

The verified EGFR result had hero mean iPTM 0.913870, hero min iPTM 0.904600, and all four hero critics above 0.9.

Binder sequence:

SAVKHLLEIVKYLEEAIEKALEVDPVFLVPPAAEELLIAAKVIKELAKENPELIEVYELLMKAVKGLKKLVRSNDKEILREVIRLLRKAAKVIREILKNNPDLDPELRKALEELAKVLEEIAEVLEQQ

See Binder Design Example for output files, per-critic metrics, pI filtering, optional scaling critics, and caveats.


ESMFold

Organization: Meta AI (wrapped by Synthyra) Architecture: ESM2 backbone + structure module with optional experimental Test-Time Training (TTT) Checkpoints: Standard

Loading

from transformers import AutoModel

model = AutoModel.from_pretrained("Synthyra/FastESMFold", trust_remote_code=True, dtype=torch.float32)

Key Details

  • Inherits from transformers.EsmForProteinFolding with the ESM2 backbone replaced by FastEsmBackbone
  • Supports all attention backends via config.attn_backend
  • TTT is disabled by default and must be requested with ttt=True or fold_protein_ttt(...)
  • Optional experimental TTT adapts the ESM2 backbone via LoRA + masked LM before folding
  • TTT can improve low-confidence sequences, but it adds compute and may degrade already strong predictions

Structure Prediction

# Without TTT
with torch.no_grad():
    output = model.infer("MKTLLILAVVAAALA")
pdb_string = model.output_to_pdb(output)

# With experimental TTT (default: 10 optimizer steps)
result = model.fold_protein("MKTLLILAVVAAALA", ttt=True)
# result = {"plddt": float, "ptm": float, "pdb_string": str, ...}

TTT Defaults

TTT is disabled by default. Standard fold_protein(...) is a baseline fold and returns best_step=0. You can also call model.infer(...) directly for raw ESMFold outputs. Use model._ttt_cfg to tune optimizer steps, LoRA rank, and masking parameters before calling fold_protein(..., ttt=True).

model._ttt_cfg.steps = 3
result = model.fold_protein_ttt("MKTLLILAVVAAALA")