This document covers each model family supported by FastPLMs: loading, configuration, special handling, and available checkpoints.
Most sequence models (ESM2, ESM++, E1, DPLM, DPLM2, ANKH) share the same embedding pipeline via EmbeddingMixin. ESM3 exposes its own compatible embed_dataset() method for sequence embeddings. They support most attention backends, with these exceptions: ANKH supports only sdpa and flex, and ESM3 supports sdpa and flex. Structure prediction models (Boltz2, ESMFold, ESMFold2, and ESMFold2-Fast) have their own APIs.
Experimental test-time training (TTT) is available for ESM2, ESM++, ESM3, E1,
DPLM, DPLM2, ANKH, FastESMFold, and ESMFold2. It is disabled by default and is
only activated by explicit calls such as model.ttt(...),
fold_protein(..., ttt=True), or fold_protein_ttt(...). TTT trains small
LoRA adapters with a masked language modeling objective on the test protein. It
can improve difficult or low-confidence cases, but it adds test-time compute and
can degrade already strong predictions. Treat it as experimental.
Organization: Meta AI Architecture: Transformer encoder with rotary position embeddings (RoPE) Checkpoints: 8M, 35M, 150M, 650M, 3B
from transformers import AutoModelForMaskedLM, AutoConfig
# Default (SDPA backend)
model = AutoModelForMaskedLM.from_pretrained("Synthyra/ESM2-150M", trust_remote_code=True)
# With a specific backend
config = AutoConfig.from_pretrained("Synthyra/ESM2-150M", trust_remote_code=True)
config.attn_backend = "flex"
model = AutoModelForMaskedLM.from_pretrained("Synthyra/ESM2-150M", config=config, trust_remote_code=True)- Uses the standard ESM tokenizer (
EsmTokenizerfromtransformers) - Tokenizer accessible via
model.tokenizer - Backend can be set on the config before
from_pretrainedOR via the mutablemodel.attn_backendproperty after load (same mechanism as every other family). - Pre-LayerNorm architecture with a final
emb_layer_norm_after - Supports
output_attentions=Trueandoutput_hidden_states=True - Experimental TTT is opt-in via
model.ttt(seq=...); no LoRA adapters are injected during normal inference.
| Checkpoint | HuggingFace ID | Official Reference |
|---|---|---|
| ESM2-8M | Synthyra/ESM2-8M |
facebook/esm2_t6_8M_UR50D |
| ESM2-35M | Synthyra/ESM2-35M |
facebook/esm2_t12_35M_UR50D |
| ESM2-150M | Synthyra/ESM2-150M |
facebook/esm2_t30_150M_UR50D |
| ESM2-650M | Synthyra/ESM2-650M |
facebook/esm2_t33_650M_UR50D |
| ESM2-3B | Synthyra/ESM2-3B |
facebook/esm2_t36_3B_UR50D |
Organization: Biohub Architecture: Transformer encoder with configurable rotary embeddings (scaling, interleaving) Checkpoints: Small (300M), Large (600M), 6B
from transformers import AutoModelForMaskedLM
model = AutoModelForMaskedLM.from_pretrained("Synthyra/ESMplusplus_small", trust_remote_code=True)- Uses the ESM tokenizer (same as ESM2)
- Requires
sequence_idparameter for batched inference:sequence_id = attention_mask.to(dtype=torch.bool) - Uses
einopsfor tensor reshaping operations - Rotary embeddings support
interleavedmode andscale_base/scaling_factorfor dynamic scaling - Backend can be set on the config before
from_pretrainedOR via the mutablemodel.attn_backendproperty after load. - Experimental TTT is opt-in via
model.ttt(seq=...); it adapts the PLM backbone only.
tokenizer = model.tokenizer
tokenized = tokenizer(sequences, return_tensors="pt", padding=True)
tokenized = {k: v.to(device) for k, v in tokenized.items()}
tokenized["sequence_id"] = tokenized["attention_mask"].to(dtype=torch.bool)
with torch.inference_mode():
output = model(**tokenized)| Checkpoint | HuggingFace ID | Official Reference |
|---|---|---|
| ESM++ Small (300M) | Synthyra/ESMplusplus_small |
biohub/ESMC-300M |
| ESM++ Large (600M) | Synthyra/ESMplusplus_large |
biohub/ESMC-600M |
| ESM++ 6B | Synthyra/ESMplusplus_6B |
biohub/ESMC-6B |
The FastPLMs binder design tutorial uses ESM++ as the masked-LM
pseudoperplexity regularizer on mutable binder residues. The verified EGFR run
uses Synthyra/ESMplusplus_6B by default, paired with FastPLMs ESMFold2
experimental checkpoints for differentiable folding and final criticism.
See Binder Design Example for the full local and Modal workflow, official selection metrics, and the verified EGFR 128 amino acid minibinder result.
Organization: Biohub Architecture: Multimodal protein model over sequence, structure, and function tracks Checkpoints: Open Small
import torch
from transformers import AutoModel
model = AutoModel.from_pretrained(
"Synthyra/ESM3_small",
trust_remote_code=True,
dtype=torch.bfloat16,
device_map="cuda",
)AutoModelForMaskedLM also resolves to the same ESM3 wrapper class, which returns sequence logits plus ESM3 track logits.
- Supports sequence-only inference by default via
input_idsandattention_mask. - Additional ESM3 tracks can be passed as tensors:
structure_tokens,ss8_tokens,sasa_tokens,function_tokens,residue_annotation_tokens,average_plddt,per_res_plddt,structure_coords,chain_id, andsequence_id. - Exposes
forward_sequence()andtokenize_sequences()helpers for ergonomic sequence inference. - Supports
embed_dataset()with pooledmean,cls, andmaxembeddings, plus residue-wise embeddings throughfull_embeddings=True. - Supports
sdpaandflexattention backends. - Includes the Biohub ESM MIT license in the Hub
LICENSEfile and model card metadata. - Experimental TTT is opt-in via
model.ttt(seq=...)and usessequence_logitsonly.
| Checkpoint | HuggingFace ID | Official Reference |
|---|---|---|
| ESM3 Small | Synthyra/ESM3_small |
biohub/esm3-sm-open-v1 |
Organization: Profluent Bio Architecture: Transformer with within-sequence and global (block-causal) attention layers Checkpoints: 150M, 300M, 600M
from transformers import AutoModelForMaskedLM
model = AutoModelForMaskedLM.from_pretrained("Synthyra/Profluent-E1-150M", trust_remote_code=True)- Sequence mode: E1 does not use a standard HuggingFace tokenizer. Tokenization is built into the model via
E1BatchPreparer - Uses RMSNorm (not LayerNorm)
- Grouped-query attention (num_key_value_heads < num_heads)
- Two attention layer types that alternate:
WITHIN_SEQ: Attention within individual sequences onlyGLOBAL: Cross-sequence block-causal attention
- Separate RoPE configurations for within-sequence and global attention (different
rope_theta) - KV caching via
DynamicCachefor efficient generation - Backend can be set on the config before
from_pretrainedOR via the mutablemodel.attn_backendproperty after load. - Experimental TTT is opt-in via
model.ttt(seq=...); the E1 path carriesinput_ids,within_seq_position_ids,global_position_ids, andsequence_ids.
E1's tokenization happens via model.model.prep_tokens:
batch_kwargs = model.model.prep_tokens.get_batch_kwargs(sequences, device=device)
# Returns dict with:
# input_ids, within_seq_position_ids, global_position_ids,
# sequence_ids, labels, context, context_lenFor the embed_dataset() pipeline, pass tokenizer=None and the mixin handles E1's sequence mode automatically.
embeddings = model.embed_dataset(
sequences=["MKTLLILAVVAAALA", "MALWMRLLPLLALL"],
batch_size=2,
tokenizer=None, # E1 uses sequence mode
pooling_types=["mean"],
save=False,
)FastPLMs exposes E1 MSA context utilities directly on the model object:
a3m_path = model.search_homologues(
sequence="MALWMRLLPLLALLALWGPDPAAA",
output_dir="msas",
provider="colabfold",
)
scores = model.score_ppll(
sequences=["MALWMRLLPLLALLALWGPDPAAA"],
a3m_path=a3m_path,
ensemble=True,
)
embeddings = model.embed_with_msa(
sequences=["MALWMRLLPLLALLALWGPDPAAA"],
a3m_path=a3m_path,
pooling_types=["mean"],
)MSA parsing and context sampling match Profluent's official E1 msa_sampling behavior. score_ppll() intentionally differs from the official E1Scorer: FastPLMs reports mean correct-token probability for each scored sequence and optionally averages across sampled contexts, rather than computing mutant deltas against a parent sequence. This is much cheaper and is the preferred scoring path here.
| Checkpoint | HuggingFace ID | Official Reference |
|---|---|---|
| E1-150M | Synthyra/Profluent-E1-150M |
Profluent-Bio/E1-150m |
| E1-300M | Synthyra/Profluent-E1-300M |
Profluent-Bio/E1-300m |
| E1-600M | Synthyra/Profluent-E1-600M |
Profluent-Bio/E1-600m |
E1 compliance tests require the official E1 package:
pip install E1 @ git+https://github.com/Profluent-AI/E1.gitThis is pre-installed in the Docker image.
Organization: ByteDance Architecture: Diffusion-optimized transformer based on ESM2 architecture Checkpoints: 150M, 650M, 3B
from transformers import AutoModelForMaskedLM
model = AutoModelForMaskedLM.from_pretrained("Synthyra/DPLM-150M", trust_remote_code=True)- Uses the ESM tokenizer (same as ESM2)
- Backend can be set on the config before
from_pretrainedor via the mutablemodel.attn_backendproperty after load. - Architecture extends
EsmConfigandEsmPreTrainedModelfrom HuggingFace - Supports cross-attention and KV caching for generation
ModifiedEsmSelfAttentionextends the officialEsmSelfAttentionwith multi-backend support- Experimental TTT is opt-in via
model.ttt(seq=...); normal DPLM inference and diffusion APIs are unchanged.
model = AutoModelForMaskedLM.from_pretrained("Synthyra/DPLM-150M", trust_remote_code=True)
model.attn_backend = "flex" # Updates every attention layer in-place| Checkpoint | HuggingFace ID | Official Reference |
|---|---|---|
| DPLM-150M | Synthyra/DPLM-150M |
airkingbd/dplm_150m |
| DPLM-650M | Synthyra/DPLM-650M |
airkingbd/dplm_650m |
| DPLM-3B | Synthyra/DPLM-3B |
airkingbd/dplm_3b |
Organization: ByteDance Architecture: Multimodal diffusion transformer handling both sequence and structure tokens Checkpoints: 150M, 650M, 3B
from transformers import AutoModelForMaskedLM
model = AutoModelForMaskedLM.from_pretrained("Synthyra/DPLM2-150M", trust_remote_code=True)- Uses the ESM tokenizer
- Multimodal input: Handles both amino acid tokens and structure tokens in packed sequences
- Mutable
model.attn_backendproperty (same as DPLM) - Special token normalization:
_normalize_dplm2_input_ids()maps tokens above vocab_size back into range - Packed multimodal layout detection:
_has_packed_multimodal_layout()checks if input_ids contain interleaved AA and structure tokens - The official DPLM2 has an extra
contact_headnot present in the FastPLM version, so weight compliance testing is skipped for this family - Experimental TTT is opt-in via
model.ttt(seq=...); it adapts only LoRA weights on the PLM backbone.
| Checkpoint | HuggingFace ID | Official Reference |
|---|---|---|
| DPLM2-150M | Synthyra/DPLM2-150M |
airkingbd/dplm2_150m |
| DPLM2-650M | Synthyra/DPLM2-650M |
airkingbd/dplm2_650m |
| DPLM2-3B | Synthyra/DPLM2-3B |
airkingbd/dplm2_3b |
Organization: Elnaggar Lab Architecture: T5-style encoder with bidirectional gated GELU FFN and learned relative position bias (bucketed) Checkpoints: Base, Large, ANKH2-Large, ANKH3-Large, ANKH3-XL
from transformers import AutoModelForMaskedLM, AutoConfig
# Default (SDPA)
model = AutoModelForMaskedLM.from_pretrained("Synthyra/ANKH_base", trust_remote_code=True)
# Flex backend (block-mask aware)
config = AutoConfig.from_pretrained("Synthyra/ANKH_base", trust_remote_code=True)
config.attn_backend = "flex"
model = AutoModelForMaskedLM.from_pretrained("Synthyra/ANKH_base", config=config, trust_remote_code=True)- Uses the checkpoint-matched ANKH T5 tokenizer exposed through each Synthyra checkpoint
- Tokenizer accessible via
model.tokenizer - Backend can be set on the config before
from_pretrainedOR via the mutablemodel.attn_backendproperty after load (same mechanism as every other family). - Attention is unscaled (no
1/sqrt(d_kv)factor). T5 trains without scaling; the learned relative position bias absorbs the temperature. - Only
sdpaandflexare supported. Requestingkernels_flashsilently falls back toflex(orsdpaif flex is unavailable) because flash kernels can't accept additive position bias. - Layer 0 owns the relative-position-bias
nn.Embedding; subsequent layers receive the precomputed bias through the forward call. - The native ANKH checkpoint is a T5 encoder-decoder; FastPLMs uses the encoder only and bolts on a separate
lm_headfor theForMaskedLMvariant. For weight-parity comparisons againsttransformers.T5EncoderModel, the FastPLMslm_head.weightis allowlisted as an expected extra parameter. - ANKH3 checkpoints use 256-token tokenizers, while ANKH v1/v2 checkpoints use 144-token tokenizers. Use the checkpoint tokenizer through
model.tokenizerorAutoTokenizer.from_pretrained(<checkpoint>). - Experimental TTT is opt-in via
model.ttt(seq=...); the ANKH MaskedLM head is not pretrained for standard MLM, so results should be treated especially cautiously.
| Checkpoint | HuggingFace ID | Official Reference |
|---|---|---|
| ANKH-base | Synthyra/ANKH_base |
ElnaggarLab/ankh-base |
| ANKH-large | Synthyra/ANKH_large |
ElnaggarLab/ankh-large |
| ANKH2-large | Synthyra/ANKH2_large |
ElnaggarLab/ankh2-ext2 |
| ANKH3-large | Synthyra/ANKH3_large |
ElnaggarLab/ankh3-large |
| ANKH3-XL | Synthyra/ANKH3_xl |
ElnaggarLab/ankh3-xl |
Organization: MIT / Various Architecture: Diffusion-based structure prediction model Checkpoints: Standard
from transformers import AutoModel
model = AutoModel.from_pretrained("Synthyra/Boltz2", trust_remote_code=True, dtype=torch.float32)- Structure prediction model, not a sequence encoder. Does not inherit from
EmbeddingMixin - Uses
AutoModel(notAutoModelForMaskedLM) - Custom featurization pipeline via
minimal_featurizer.build_boltz2_features() - Outputs atomic coordinates, pLDDT, pTM, ipTM confidence scores
- Can export predictions as CIF files via
model.save_as_cif(output, "pred.cif") - TTT is not supported for Boltz2 in FastPLMs.
output = model.predict_structure(
amino_acid_sequence="MSTNPKPQRKTKRNTNRRPQDVKFPGG",
recycling_steps=3,
num_sampling_steps=200,
diffusion_samples=1,
)
print(output.sample_atom_coords.shape) # (N_atoms, 3)
print(output.plddt.shape) # (N_residues,)Boltz2 compliance is tested via a standalone script (testing/run_boltz2_compliance.py) that compares coordinates, pairwise distances, and TM-scores against the official implementation.
Organization: Biohub Architecture: ESMC-backed diffusion structure predictor Checkpoints: Full, Fast, Experimental, Experimental-Fast, Cutoff2025 variants
import torch
from transformers import AutoModel
model = AutoModel.from_pretrained(
"Synthyra/ESMFold2-Fast",
trust_remote_code=True,
dtype=torch.float32,
).eval().cuda()- Uses
AutoModel, notAutoModelForMaskedLM. - Can fold single chains and multi-chain complexes.
- Loads the embedded PLM through
Synthyra/ESMplusplus_6Bby default, using FastPLMs ESM++ withconfig.esmc_attn_backend = "flex". - Exposes
fold_protein(),fold(),prepare_structure_input(),result_to_cif(), andresult_to_pdb(). - Experimental checkpoints support
res_type_softfor differentiable binder sequence optimization. - Final scoring can report pTM, iPTM, pLDDT, structures, and distogram logits.
set_kernel_backend(),set_chunk_size(), andapply_torch_compile()are available on the ESMFold2 wrappers.- Experimental TTT is opt-in via
fold_protein(..., ttt=True)orfold_protein_ttt(...); it trains LoRA adapters only on_esmc, not the folding trunk, confidence head, or diffusion head.
| Checkpoint | HuggingFace ID | Use |
|---|---|---|
| ESMFold2 | Synthyra/ESMFold2 |
Full released structure predictor |
| ESMFold2-Fast | Synthyra/ESMFold2-Fast |
Faster released structure predictor |
| ESMFold2-Experimental-Fast | Synthyra/ESMFold2-Experimental-Fast |
Binder inversion and hero critic |
| ESMFold2-Experimental-Fast-Cutoff2025 | Synthyra/ESMFold2-Experimental-Fast-Cutoff2025 |
Binder inversion and hero critic |
| ESMFold2-Experimental | Synthyra/ESMFold2-Experimental |
Final hero critic |
| ESMFold2-Experimental-Cutoff2025 | Synthyra/ESMFold2-Experimental-Cutoff2025 |
Final hero critic |
The FastPLMs binder workflow lives at
cookbook/tutorials/binder_design_fastplms.py and supports local CUDA or Modal
execution. The optimizer follows the official ESM strategy: continuous amino acid
logits, cysteine suppression, ESMFold2 distogram structure losses, ESM++
pseudoperplexity, late-trajectory iPTM selection, and final critic ranking.
python cookbook/tutorials/binder_design_fastplms.py \
--backend local \
--target-name egfr \
--binder-sequence '################################################################################################################################' \
--not-antibody \
--steps 150 \
--batch-size 1 \
--seed 103 \
--output-dir binder_design_egfr_len128_seed103The verified EGFR result had hero mean iPTM 0.913870, hero min iPTM
0.904600, and all four hero critics above 0.9.
Binder sequence:
SAVKHLLEIVKYLEEAIEKALEVDPVFLVPPAAEELLIAAKVIKELAKENPELIEVYELLMKAVKGLKKLVRSNDKEILREVIRLLRKAAKVIREILKNNPDLDPELRKALEELAKVLEEIAEVLEQQ
See Binder Design Example for output files, per-critic metrics, pI filtering, optional scaling critics, and caveats.
Organization: Meta AI (wrapped by Synthyra) Architecture: ESM2 backbone + structure module with optional experimental Test-Time Training (TTT) Checkpoints: Standard
from transformers import AutoModel
model = AutoModel.from_pretrained("Synthyra/FastESMFold", trust_remote_code=True, dtype=torch.float32)- Inherits from
transformers.EsmForProteinFoldingwith the ESM2 backbone replaced byFastEsmBackbone - Supports all attention backends via
config.attn_backend - TTT is disabled by default and must be requested with
ttt=Trueorfold_protein_ttt(...) - Optional experimental TTT adapts the ESM2 backbone via LoRA + masked LM before folding
- TTT can improve low-confidence sequences, but it adds compute and may degrade already strong predictions
# Without TTT
with torch.no_grad():
output = model.infer("MKTLLILAVVAAALA")
pdb_string = model.output_to_pdb(output)
# With experimental TTT (default: 10 optimizer steps)
result = model.fold_protein("MKTLLILAVVAAALA", ttt=True)
# result = {"plddt": float, "ptm": float, "pdb_string": str, ...}TTT is disabled by default. Standard fold_protein(...) is a baseline fold and
returns best_step=0. You can also call model.infer(...) directly for raw
ESMFold outputs. Use model._ttt_cfg to tune optimizer steps, LoRA rank, and
masking parameters before calling fold_protein(..., ttt=True).
model._ttt_cfg.steps = 3
result = model.fold_protein_ttt("MKTLLILAVVAAALA")